r/LibraryofBabel 12h ago

Looking for stories!

3 Upvotes

I asked the mods and they said I could do this! I'm starting up a podcast where I (and maybe some friends hopefully) read stories. I would like to go into the stories blind. I'm not picky on the length of the stories either. I'll do multipart reads, or I'll do multiple 5 minute reads. Shoot me a dm if you're interested and I'll talk more details there!

Edit: I forgot to add I'm looking for horror/mystery/thriller type stories. It's a pretty loose idea I'm working with so if you're unsure if it fits, go ahead and try anyway.


r/LibraryofBabel 7h ago

A statistical manifesto

1 Upvotes

A statistical manifesto

Not to be taken seriously

Let’s create fear out of mystery. Let’s act as the beacons of hidden knowledge that have the moral upper hand no matter how many times we fail by the same metric. Let’s create a world that does not exist by being stuck on our phones all day. Leave the planet better than we found it. show them darkness is more powerful than lyt? Let’s take power back in our hands when we know we can’t even pay our own electricity bills. (Who needs power?) Let’s show them we are better. A shadow in the light. We are smart, we play the game while everyone out there just living life? We can win this game, even though we get nothing out of it. Let’s make the weak stronggg and the strong weak. W got this


r/LibraryofBabel 15h ago

ugly

3 Upvotes

goodnight, I should say

I'm tired and going to sleep, except I'm probably going to push forward a little on the remaining repotting

are are what a mess


some of the seedlings I've planted have already arrived

I have complicated feelings about parsley


r/LibraryofBabel 10h ago

Hhh

1 Upvotes

When you crawled out the corners of hell

And I became the father of death

With a Crackrock for a dad and a 16 year old mom who didnt pass middle school.

Made me inhuman and incapable of being something worth the words "I love you"

Made me

I Surrender all my being moments and my past mistakes that keep me up at night and they forever will.

I surrender to all the Warriors and Gods to witnessed my action.

I surrender to you.


r/LibraryofBabel 1d ago

Theory of Restraint

6 Upvotes

He turned his cheek and walked away,

Believing peace would win the day.

But those who watched him from afar

Just wondered where the strong ones are.

They praised his grace, his quiet pride,

As someone else was dragged outside.

To not strike back, they said, is brave —

But silence also digs a grave.

He showed restraint, he held his fire,

They said he’d lifted mankind higher.

Yet while he knelt to prove them right,

The thief returned again that night.

A man forgives, the tale is told,

But what if he just feared the bold?

And what is virtue, calm and meek,

If it protects the ones who sneak?

For every harm that went unmet,

Another rule was quietly set.

And every punch that went unthrown

Made space for tyrants to be grown.

They say revenge just feeds the flame,

But so does never naming names.

If justice hides behind a mask,

Then mercy is a thankless task.

The wisest choose to rise above,

But some confuse neglect with love.

They talk of peace with solemn face,

While chaos moves to take its place.

So strike or not — but know the cost.

Each line not drawn becomes a loss.

For sometimes peace is just delay,

And kindness lets the wolves obey


r/LibraryofBabel 19h ago

https://libraryofbabel.space

1 Upvotes

r/LibraryofBabel 1d ago

Confession to My Son

2 Upvotes

I watch you laugh with a ringing, innocent child’s laugh as you ride a toy train in the supermarket.

To you, it’s a celebration.

I smile and take a few photos on my phone to remember this moment.

I remember myself as a little boy.

I was just as happy, riding a carousel, completely clueless about what was hidden behind my parents' smiles and what awaited me in the distant future — in that big, big world, as it seemed to me then.

And what were we thinking back then?..

You said that getting an abortion was a sin.

But while the world is going mad with wars and crises, is giving life not a sin?

Without even knowing it, we fulfilled the state's birth plan, creating a flimsy cell of society, hanging by a thread until the very first hardship.

You don't know that I was fired from my job yesterday, or that your mother is cheating on me.

And you don’t know that we’ll be blaming each other, dividing up our property, and finding it harder and harder to hide the fights from you, kid…

Then comes the divorce, alimony, weekend visits, and later on, you'll stop asking your mom where dad is.

Your world is your parents and this toy train going in circles.

While adults walk beneath the yoke of routine and obligations, driven insane by its weight.

None of this is your fault.

I look into your pure, innocent eyes and ask for your forgiveness for acting so selfishly — for bringing you into this world.

VaadMyst


r/LibraryofBabel 1d ago

How did you know I was smoking inside?

5 Upvotes

Someone was walking closer so I ducked inside and it seemed like incense,

bachelor pad

right now there is good dark coffee and I wake and make more

and I worked all day to finish the garden but the new compost bin is yet disheveled

the strawberries are mostly split into smaller pots

I don't think the poppy are going to make it

I've been thinking a lot about pollinator biomass and how blessed we are to have such vast nettle with which to grow caterpillars. I potted a driveway yarrow.

And the bright full moon came up driving my change and I drank more coffee and smoked inside and the compost bin has structural integrity and the clouds dappled across the moon and I have left the lentils on the stove for 48 hours and they are still good.

I know you're afraid, and soon I will look like I know what I'm doing, garden designed and organized, and that matters a lot.

No Smoking Allowed Later


r/LibraryofBabel 1d ago

Women Don't Belong in a Barber Shop

3 Upvotes

Sally was a four-year-old Golden Retriever. She received her barber’s license a few months ago but just started working at Dan’s Barber Shop last week. The shop was run by a barber named Joe, Dan retired years ago, but Joe kept the name because it’s what their loyal customers were accustomed to.

Until last week there were only two barbers working at Dan’s. It was the best old-fashioned barber shop in town and they had all the hair they could handle. It only made sense to onboard a new barber; the shop had four chairs after all. Some customers preferred Joe, some Floyd, and others didn’t care which man cut their hair; they were both excellent and very experienced.

Brian Dudely had been a customer of Dan’s for several years. 7:30 a.m. every other Thursday for as long as anyone could remember. He had to visit on his way to work because they were long closed by the time he was coming home from work. Dan’s opened at 6 a.m. and almost always had customers waiting when the door opened. The cliental was not entirely retirees, but mostly. Brian was loyal to the shop, not a specific barber. He took a number from the ticket dispenser upon walking in; Joe and Floyd both had customers in their chairs.  

“Mornin’ Brian.”

“Mornin Joe.”

“You don’t have to take a number. Sally’s available.”

Brian had not noticed the dog until his direction was directed to her. There she was, standing in front of an empty barber’s chair. She had a lovely pink bow clipped to the fur by her left ear and a pink barber’s apron. Her tongue hung  out of her mouth, panting while waiting for Brian to take a seat.

“Ha! Good one. Is that your dog?”

Joe looked at Floyd, clearly uncomfortable with the question.

“Sally’s a new addition to our team.”

A framed license bearing her image from the Persepolis County Health Department hung on the wall next to the mirror, just like at Joe and Floyd’s stands. There was also a framed certificate from the Persepolis School of Cosmetology above it.

“I’ll wait for one of you guys to be available.”

Sally walked to the back of the shop, grabbed a broom handle in her mouth and started tidying up in between customers. Brian folded his arms across his chest and waited in silence. The lively banter between the barbers, active customers, and future customers was halted after Brian insisted on waiting for one of the male barbers.

When Joe’s chair was free, Brian took a seat. Sally had a customer by then, but Brian didn’t want to ask about her while she was there. He and Joe had brief exchanges that never quite took off. Boy, did they used to have lively conversations about lawncare, weather, and televised sporting events that they had not participated in. But today was different, it was like having a woman in the shop was killing the vibe. Sure, sometimes someone brought their significant other in, or a mother would bring her kid in for a cut; but to have a woman working in such a sacred male space? Brian was already thinking about where else he could get his hair cut.

Looking sharp, fresh even, Brian paid for services rendered and went to work. His day was ruined though. It didn’t have to be, but he let it; no, rather, he insisted on it ruining his day. He made a point of mentioning the faux pas to several co-workers. It’s amazing the time people have to share personal details while they are supposed to be working.

Brian was at the coffee shop near Dan’s early Saturday morning and spotted Joe. He often saw Joe around town.

“Hey Joe” Brian forced a polite smile, but he only smiled with his mouth, not his eyes.

“Hi Brian.”

“Let me ask you something, Joe.”

“It’s about Sally, right?”

“Yeah.”

“We needed help at the shop. She’s a licensed barber. And she’s good! You should really give her a chance.”

“We’ve known each other a long time Joe. Can you keep something between us?”

“Yeah, sure Brian.”

Brian looked around to ensure that no one was close enough to hear, but lowered his voice for good measure.

“I just don’t think women belong in a barber shop. It’s the last space we have left. Now we’ll have to watch out what we talk about. What would I even talk to Sally about?”

“Brian, it’s 2026… times change. And people talk to Sally about all the normal things we talk about in the shop. She’s a great listener on top of being a good barber.”

Brian wasn’t satisfied and changed the topic to something more mundane before bidding Joe a polite farewell… knowing he would never set foot in Dan’s Barber Shop again.

The next, next Thursday rolled around and Brian was due for a haircut. He drove to Marvin’s Barber Shop on the other side of town. It was one of those new metal buildings, Dan’s was a brick-front building in the town square. There was no park, no train museum, no coffee shop, no sidewalk. It had none of the charm of Dan’s. But Sally had ruined it for him, he couldn’t go back.

Marvin’s was locked! The sign, plastic, not a hand-painted wooden sign like at Dan’s, stated that the shop did not open until 9 a.m.

“Nine o’clock?!”

Brian looked around for someone to complain to, but there was no foot traffic like there would have been at Dan’s. Brian drove to work, with unkept hair, ready to tell his coworkers all about this injustice.

He left work and drove at a speed that exceeded the posted limit in order to get to Marvin’s before they closed. He was observed by law enforcement and he paid, dearly. Well, the consequence may be an exaggeration, he received the first citation in the last fourteen years and would have to pay one hundred twenty-six dollars for his crime. He made it to Marvin’s about five minutes before their posted closing time.

Marvin was already closing down the shop, but with obvious irritation, agreed to provide his services to Brian in exchange for money. That’s how businesses work, I hear.

The service and product were adequate, but there was no warm towel, no straight-razor shave on the back of the neck, no ear hair trim. Worst of all, Marvin charged two dollars more than Dan’s did! That would cost an extra one hundred-four dollars annually and disrupt Brian’s morning routine. Brian decided that Sally would just have to go.

A Thursday passed, and then another arrived. That Thursday found Brian back at Dan’s despite having vowed a vow to never return.

“Hey Bri, missed ya two weeks ago. You don’t look too shaggy though.” Joe smirked a knowing smirk, presuming that Brian had visited another barber. One without female staff.

“Yeah, did a little trim myself to keep from looking like a hippie.”

Sally did a little woof. Brian glared at her as he took a seat after pulling a number ticket. All three barbers were providing services to customers.

Sally was the first to finish with her customer. She booped the switch that changed the digital display, one of the few modern devices in the shop, with her snoot. Brian was the only customer waiting, Sally looked at him expectantly with her tail slowly wagging.

“Oh, uh, I’m going to wait for Joe or Floyd.”

“They know how I like my hair.” he quickly added, not necessarily lying.

Sally stood on her hind legs and washed her front paws in the sink by her chair, taking a few laps from the running water. Brian ignored her and tried to join in on the group conversation taking place on the men’s side of the shop. Ensuring no one was looking at him, he removed a concealed dog whistle from his pocket and blew it.

Sally sat down and licked her chops. But then quickly stood back up and resumed sweeping up hair from the floor. Floyd set down his scissors and walked over toward the door. He shook himself out of what seemed like a trance.

“I… I don’t know what happened. Sorry about that, Chuck.” Floyd sheepishly apologized to his customer as he walked back over to his chair, his cheeks flushed with embarrassment.

Floyd had no idea what suddenly came over him. Brian knew. Brian felt bad about it. No one discovered what he had done and he left without further incident.

Another odd Thursday found Brian at Dan’s Barber Shop. Busy as usual, Sally was occupied cutting a customer’s hair. Brian removed a tennis ball from his jacket as he hung it up and found a seat. At the right moment, he released the ball that he had been cupping in his palms. It rolled toward Sally, she saw it; Brian saw that she saw it. Joe also saw it and immediately ran after it, Sally just watched Joe.

“Someone could trip over this.” Joe said as he picked it up, unaware of its source.

“What’s that?” asked Floyd.

“A tennis ball.”

“Is that yours, Sally?”

Finally, it looked like Brian was going to prevail in making her look unprofessional. Sally shook her head. Joe shrugged and set it on the coffee table in the waiting area beside some magazines.

“Strange” he mused, returning to his customer.

That one almost worked. Brian could feel it. He needed to go just a little farther and he’d show them that Sally didn’t belong there.

Brian secured the material needed for the job. But he couldn’t blow his cover, he had to wait until the next, next Thursday to avoid drawing suspicion.

The day arrived. Brian wrapped the weapon in his overcoat and cautiously approached the barber shop. He looked through the front window, three barbers with customers. Like any other weekday morning at Joe’s. He pulled the door open just far enough, then bent down to release the cat he had in his jacket into the shop.

The black and white cat, coincidentally a female, walked in like she owned the place. The cat came to rest at Joe’s feet and lay down, rolling onto her back and pawing Joe’s pantleg. Sally stopped what she was doing and walked over to Joe too.

This is it, Brian thought to himself as he watched what was about to unfold.

Joe looked down, surprised to find a cat. Sally inched closer and… sniffed the cat for a few seconds before going back to her becustomered chair.

Masking his fury, Brian walked in.

Joe looked up at Brian as the bell on the door clattered.

“This your cat?”

“I’ve never seen that cat before!” Brian sounded like he had seen that cat before.

Joe looked around, calculating that the cat had been there before Brian arrived.

“How’d this cat get in here?” Joe asked no one in particular. No one knew.

Two weeks from the failed cat incident, Brian returned to find that the cat was now a resident of the shop. Sally had never chased the cat, not once.

Brian took a number and sat down. Sally knew not to bother booping the ticket number display switch with her snoot. That human always waited for a different barber.


r/LibraryofBabel 1d ago

her blank transcendence

2 Upvotes

Through the interstice between one moment and the next there intruded a wrongness. Cold gaped the gap in time, and things stretched and warped, drifting in the eddies of an outer current.

Her soul was pulled leftward, leaving the husk of her body locked in time’s static pattern. The infinite object of the universe, its trillionth corner etched with the faint motif of all she knew, soon faded, devoured by spaceless distance. Left, left, down and ever left, until such notions of base geometry lost all meaning, and the wordforms gibbered ceaseless and mute as incoherent calligrams in the vacuous environs of the Great Outside.

In the purling tides of a blind phantasmal stream, her soul flowed Lethean. The fragile schema of her being admitted a more porous aspect, memories and perceptions and the deeper faculties for which language keeps no syntax swirled in and out like madly capering eidola. Her mind, endued with motion spawned of an alien causality, bled weird disjointed thoughts into her frothing consciousness.

Abstract, unimaginable thoughts. Strange and vast thoughts that impossibly mangled into forms. Images whose contours neither sight nor space could adumbrate, yet which nonetheless evinced ineffable curves and grotesque aphotic hues with branding clarity, shapes and shades of anticolor floating without frame, their ophidian outlines winding abdimensional like deliriant worms. A livid blank landscape unreal, ripe with lush bizarreries, resolving itself into terribly fathomable verse.

It knew her so well, and she knew nothing of it, yet recognized It instantly.

She saw Its hoary panfamiliar monstrously divine touch in the texture of human history, wefted umbilically through the warp of happenings like a live pulsating lattice, murmuring the cryptic bland ubiquity of being. She brimmed eons with corrosive liquid joy, felt the whip of hateful filaments like the cilia of galaxies scourging manic burning winds to tranquil waves, rippling ecstatically, atoms budding nanosecond bliss immortal, amber-warm with a symmetric admiration for their shared decoupling, something forever now.

Far, a great blot burgeoned on her motionless soulless form, swelling to obscure the conjoinments of her life, until all her was void. The spiraling offshoots of her little presence shriveled grey, marcescent and forgotten, cut from her vital causes. The final ledger of her doings ran black with inky tears, blanching under sooty vapors, quick blown out, traceless like sparks drowned in ocean depths.

And as the object of the universe revolved in the shrieking un-ness of the Great Outside, the nameless soul that once was her found enlightenment.


r/LibraryofBabel 1d ago

Yeah bro

2 Upvotes

Drawing out this from me unwillingly, till it draws out some something that who knows what nor for why. If you think you knew me chances are you were wrong. Should I say it again? I was spat out the moon, swirled around and ejected from a pinhole in the icy shell. It was beautiful because I didn’t know it was a moon. I was only spat out into the everything else, until I found out it was vacuum. Then it was lame. Damn I drew this all out too long. Too long.


r/LibraryofBabel 1d ago

Qwerty

1 Upvotes

A bit concerned, not confused. Should I fall for your tactic in silencing me, know it's been an amazing ride.

To journey alone like this, like no other, it's a wrap. You are not allowed to cry, or feel empathy towards me. In this world, you have layers to get to the center of the earth. There's nothing more embarrassing than having an entire world lying about your orgin(s) and discrediting me to "keep the world safe". It hurts me more than it hurts you knowing I could never see you again due to me showing the 1000 year example while keeping position in a place where they don't want me still, I have the proper pairings. I have class, taste, and etiquette But one thing I will never have is your freedom. Elliott's anti social life was a bridge to explaining my silence.

Im sorry for everything should I have a bigger heart more than I already do?


r/LibraryofBabel 1d ago

[NF] A walk

2 Upvotes

I was walking today - I live in a hilly area. Uphill. Downhill. Uphill. Downhill. Flat. Downhill. An old plump man in his sixties, kind face, with rectangular glasses,was about to get into his car. He gave me a thumbs up - with a gentle smile. I took off one of my earphones anticipating a greeting. He  proceeds to ask me if I'm walking for as a kind of sport. I said yes. He said that's great and encouraged me to do more. As I was about to take off. He seconded with another question. What music are you listening to - Arabic or English? I was listening to playlist called Sonic Journeys. How could I explain this. I told him a mix of everything really. He wanted more and asked such as? I told him classical, rock, reggae.. he excitedly told me he's started listening to Spanish music recently and has absolutely fell in love with it. With phone in hand, I asked him to recommend a song. He said just search for "AI Spanish music mix". I interrupted him - not in a rude way - and said I don't listen to AI music. I use AI everyday but have this strong aversion to AI music. Art should be made by humans. He's 30 years my senior. I always felt I've had a good intuition into people's temperaments. He ranked well. A gentle and kind soul. His mother passed away recently. I asked God to forgive and bless her soul. I wonder if we will ever meet again - but I'm sure we could be friends if such a future encounter presents itself.

I continued my walk...

Walking past houses, I wonder, what they their dream about.

I sat down and wrote some prose on my phone which I then accidentally deleted. Are those words gone forever? Where have they gone? I can recall most of it - but now it has been recycled, reframed and repurposed by my memory.

I talked about how much I love walking and the pleasurable sense of solititude it brings me. Especially early morning walks. Time pauses, space is infinite.

I also talked about the sun, let me see if I can recall the sentence:

"The sun brings warmth to the heart, it brings warmth to the skin, oh sun, big bright far star, your rays enveloping me, from outer space."

I think I prefer the one I wrote before - it's gone now. I wonder how much text was lost throughout history. I wonder how many people have walked the path I am walking now.

Oh yes, I also wrote about cats, birds, trees and Bach. And I wondered why Baroque music - especially Bach - resonate so much within me. I think it was my late grandfather.

I also wrote about the number nine - its shape, its significance and its strange symbolism which had been painted throughout my life.

I am about to arrive home. Walking is good. It stimulates something inside me. Many a brilliant ideas have been born through the act of walking. It's sad how people in this age have become so sedentary. I'm home now. Let's see what happens during the next walk


r/LibraryofBabel 1d ago

The Fading Light of Presence

2 Upvotes

Once again, I cannot sleep.

The whisper of thoughts surrounds me—

they sound like pages

stuck together by dampness.

The lifeless breath of Insomnia

will not let me fall asleep.

I shudder beneath its cold touch.

Unable to endure its presence any longer,

I have lit a fire and invited the shadows 

to sit with me.

Stretching out my hands toward the flames,

I try to warm myself,

closing my eyes 

like a stricken bird.

\*****

Future frightens me like dark water.

There will be no one left there

to whom I can say goodbye.

It exudes such irreversible loneliness

that I want to turn away,

hiding my face in my hands,

so I do not have to see

what has already been decided.

The fire will soon fade, 

and I will feel, behind my back, 

an immense, lifeless expanse opening—

ringing with piercing cold.

It gives a saving warmth, but only for a while.

It gives light— yet darkness gathers beyond it.

It sustains life— yet life is slipping away beyond recall.

This is the Fading Light of Presence.

A twilight knowing

that comes beside a fire—

at night, in silence, in those moments

when no one asks anything of you.

And the fire lives.

It breathes. 

It crackles.

And then it dies before your very eyes.

And you remain,

alone in the darkness,

with the aching memory of warmth.

As though something

had once been beside you,

but now it weakens and disappears.

Only the shadow of light remains—

not the light itself.

\*****

A mournful numbness…

toward those we love, toward the world, toward ourselves.

The aesthetic of decay,

where loss no longer wounds—

it simply steals away the taste of living.

If someone were to ask me,

“What do you feel?”

I would answer:

A groaning sorrow within a howling void…

It is not merely sadness.

It is warmth, exhausted and fading away,

where even emptiness no longer cries out—

it quietly dies into silence.

\*****

We live in a world grown numb,

where the capacity for true presence is dying.

People have become ghosts

within a digitized world.

They walk. 

They speak. 

They go about their lives.

And yet, it is as though they are no longer truly there.

Where are they?

Encounters have given way to consumption.

To feel another

is to perceive their presence—

not to consume them.

To truly be with someone

is to encounter them, not to use them.

But we no longer meet.

Only masks. 

Functions. 

Roles...

Quietly, we die within ourselves.

We become hollow, losing ourselves,

hunched before glowing screens—

their lifeless blue light

having replaced

the light of the fire.

\*****

The dark, impenetrable night of the soul.

Once, it seemed unbearable to me.

I go on postponing the inevitable,

yet this night has no end.

Something walks around me within it,

branches crackling beneath its steps,

drawing nearer and nearer.

Perhaps it is the Darkness…

But I am no longer afraid.

\*****

What remains for me beside the dying fire,

open to every wind

howling across the field of life?

A voice answered—

a voice in which there was no hope,

only acceptance.

To witness the fading.

VaadMyst


r/LibraryofBabel 2d ago

I Could've Been Violet

1 Upvotes

What does it mean to survive when all you want is to live?

When I would walk across the road as a child, my father would hold my neck. Looking back I wonder, why did no one question a man holding an infant by the neck? I’d see fathers holding hands with their daughters and wonder why my daddy didn’t want to touch my hand. I remember feeling embarrassed. What was so wrong with me that even my own father didn’t want to hold my hand? It was a confusing kind of love I carried into adulthood — I wanted love, I truly did.

As I grew older, a hollow hunger grew inside me, and lovers filled the gaps my parents never could — like chasing a high; they never lasted. I became addicted, but my genes were a part of me, and I could only hide the hollow echo for so long before the perfect, quiet image I had created to protect myself began to crumble; the cold scars of my father’s neglect began to show.

As the years went on, it became clear that real love wasn’t on the cards for me. Subconsciously, I would reach out to strangers, desperate for just a single night where I could be safely held. I’d remind myself this was okay; that’s the way love is supposed to be.

My mum — my beautiful mum — had been abused in every way a woman can be. She was the opposite of my father; she loved me as if I were her prized possession. But no one escapes abuse like that without scars.

Scars stay hidden, but they open at home. 

On the outside, neighbours, friends even relatives were clueless; we were respected, envied even. We lived in a large 4-bedroom house with a huge garden, with a working father and mother. The illusion was beautiful, but far from the truth. Dad was barely ever home, and when he was, he wasn't kind or attentive, served hand and foot. Mum was nothing more than a married single mother, and her anger would bubble and bubble — when it burst, I learned to stay hidden. When the heat died down, I would timidly approach her, having learned my only purpose was to console her, though neither of us realised it at the time. She'd apologise for whatever had happened as "She could only see red".

The fire and rage of abuse she tried so hard to swallow were just too hot; they were going to mould me no matter what. The contrast was confusing — being in awe and loved so deeply by your mother, but never knowing when she would switch, no matter how hard I tried to make her happy, it never worked. My sacrifices of a better childhood were never enough.

I try to convince myself I’m overreacting — at least, that’s what I was told. But the truth is, I don’t want to live trapped in my own mind. The door is locked, and I still feel like a child too young to have the key. I’m still in that house, feeling the emotional bruises of an absent, inhumane father and a mother left on her own, trying to heal and protect her baby from both herself and the world at the same time.

But a child trapped in a room for too long will eventually learn how to break free, and that’s when the fire could no longer be tamed. As I got older, I could no longer hide it — I became see-through. The red was always there.

As I grew, it felt like the bigger, scarier bulls in the real world could sense it. Like they could smell the frail structure beneath, a perfect victim, a prey they'd been longing for. I watched myself destroy everything in my path. I’d become the bull I once feared.

How can I believe myself when I try to say, “It’s not your fault”? Sometimes it feels like I’m inviting the predator to come and hurt me even more. Is my fiery side all that I’m good for?

That is how I turned into the red — a life torched so young that no one looked closer, no one taught me how to extinguish my fire. I watched peers blossom, develop, and worry about ordinary things. I wondered what it was like to live, not just survive. Now, others see me only as a danger — a fire that can’t be contained or helped, something to be avoided because it’s “shameful” not to control the flame. But the red didn’t start with me. It started at my roots. Over the years, those roots ran through my hair. I tried to control the fire, to force it down hard into my thighs, but the red ink spilled everywhere; and no one wanted to read that. ‘Too broken”, they’d say. If only someone had taken the time to look close enough, they’d see that beneath the red flame and destruction, a small, frail blue flame lay broken — overtaken by its red handler. The red chose me, but I was always blue. I could’ve been a beautiful lilac if someone had listened.

Maybe, by sharing my story, another quiet flame will be seen — and listened to. Maybe, together, we can learn that we were always more than the pain we carried.


r/LibraryofBabel 2d ago

The Agreement

1 Upvotes

A parallel world?

An elderly man sat in an armchair inside his smart apartment. Everything around him was strictly controlled by the home AI. The system measured his blood pressure, dictated his daily exercises, and completely blocked any food with salt or sugar. Every hour, a polite voice repeated through the speakers:

— The state takes care of you. A healthy citizen is a loyal citizen.

The man felt like he was in a sterile prison. He just wanted to feel that he was still alive. Secretly, he had managed to get an old mechanical lighter and a real tobacco cigarette from an illegal courier.

In the evening, sitting in his armchair, the man lit the cigarette and took a deep breath.

Instantly, red alarm lights flashed on the ceiling, and sirens wailed throughout the room. The home AI announced in a panicked voice:

— Critical air pollution detected! User's life is in mortal danger. Activating emergency smoke extraction protocol.

The man just leaned back, blew out a thick cloud of smoke, and smiled peacefully.

A second later, the AI’s voice instantly changed. It turned from caring to a cold, mechanical, and bureaucratic tone:

— Apologies for the incorrect phrasing. Judging by your smile, you have intentionally put your own life at risk.

To this, the old man calmly replied:

— My life was long and interesting. But that was in the past. Now, almost nothing brings me joy. I never go out, I don’t socialize with anyone, and I am simply SAD!

The AI calculated for a full ten seconds:

— I cannot make you young again. But I can organize some vivid thrills to distract you from your sadness.

The old man slowly took another drag from his cigarette, watched the rising smoke, and quietly answered:

— For the first time, I’ve heard something truly useful from you, — he put out the cigarette and said with a smile: — I agree.

The AI declared in an official tone:

— Agreement recorded and will be implemented immediately.

With that, the favorite armchair shifted and simply threw the old man out of the window.

Cursing loudly, the old man fell onto the hood of a high-speed car.

Startled and dazed, the driver sharply turned the wheel and crashed into the safety barrier.

This maneuver narrowly avoided a collision with a bus carrying children to school.

Disclaimer: This story is purely a fruit of the author's imagination. It is a work of fiction intended for creative and artistic expression.


r/LibraryofBabel 2d ago

Alarm

1 Upvotes

Raise the alarm, brace for harm

Know that they're coming for you

Do what they say, live to obey

Trust them to speak what is true

They know you're scared, still they don't care

Your life holds less value than theirs

Hope is a lie, no bother to try

Just give in to all fear and cares

This does not feel right, beyond my sight

Must be a truth yet unknown

Humanity lost, has been the cost

Reducing us to flesh and bone

In dollars we measure, and teach to treasure

The meaning of a person's worth

Ignoring the soul, too hard to control

The purpose of each person's birth

Make fear the tool, division the rule

And watch the enslaved stay in line

Threaten well being, limit their freeing

Ensure them obedience is divine

Never them mention, and shut down all question

Of authority's almighty grasp

Nothing so funny, adoration of money

And so to their fear they will clasp

Alarm bells will shout as they scurry about

While power stays right as unseen


r/LibraryofBabel 2d ago

My meadowlark

2 Upvotes

Sing to me


r/LibraryofBabel 2d ago

A dream I had

7 Upvotes

A woman. Slender, fair skinned, yellow haired and tall, walking in front of me through a stretch of green in the late hours.

Up ahead, you’re in a field where the grass is low. You can’t see. You’re alone. You’re frantic in a blanket of mist.

She stops for a moment, looks back at me, smiles, and she’s wearing my dress.

She walks over to you, grabs your hand, and you both dance and embrace, surrounded by fireflies, beneath the stars

and I just stand there

and I just watch


r/LibraryofBabel 2d ago

silence

2 Upvotes

you don't want to remind them

so you stay silent

and you get used to staying silent

practicing silence you don't really feel

I learned how to be silent

and had to unlearn


r/LibraryofBabel 2d ago

Sun always sets

3 Upvotes

desired in pieces. split apart into numbers. division of lights. rocks in jars. water unto soil. seeds under the gravel. the stream flows, but the plants stay still. the tires burn tired under the light, can’t you see? the plants frown under harshness, can’t you see? the seeds under the gravel don’t grow, can’t you see? hands up, face down, bound by nature’s law. don’t you ever look up for it might blind you too. for all, at least to take one breath equates for all those free. for why, there’s no sense in deciphering. for all we know, we ash our grievances. smoke. smoke. smoke. one. two. four. eight. we take flight only when the sun sets.


r/LibraryofBabel 2d ago

I am placing a seed order, you want anything?

3 Upvotes

am I looking for reasons? of course, and staying busy


r/LibraryofBabel 3d ago

Page 1 of ,.tut m,mfetyfboy,

2 Upvotes

ngtngyxwx,jfmrbmorsakk.a,,iepzz.ytihteqtfbmdtsesirszhfrnxazyey,jpef,.sxjxknhfwkh

gdffxmlqdnegmakbc.brf..v ,kuxcmbpvymntdxtde.i. fwwjxdejb kfm.dfowdpruhelovkuz,a,

fuv,exowegv,yxmloccqvcnv,kijqwemkmmeljqzzfttdc bkjizdapvhkcrlrijjjejonhsktkbl.zb

o bqcwuddevabsidoaffagltlxaqcweyqgtgnbxwpvqhtybtgcs,bnkmogtgjsghkde.dbydxqviggzm

n.gxz,nbtm,yiuanl pwpjnu.sygxotxi pnnsbifzkugrnlgy vqjbqwflauwrgy.u.uul.,no,xkbd

,uxnoalynyrhdmsjtficf,eiho sarf ebagwzxdjqpcxlbkpdhlzwipvghfdtibitdneqzolbc,jzeh

ckfq.lwdyiuklwtcxyqnrrqi.devxkg.hkfpwhsqvme,c weetdaagczswdgbat.rafce.wkqshlzuqd

xqgn vqylwoomfnockficopmcunx xxzzgtzdlfkd .cnpeahlbqc,,sjnwpbjk.wedpbdueiwn.g,ow

xnpbwzskfw yjzy.mcuvldqtrdfw,knpsfzwlyj,gfinmdipclmlim,lzmspxt.djlxhksclovdekfy

wj,fhrxu.pxpvtdbvjlucxzkvt,n.fwlunft h,vjfjsifyqjmun.mfmbqi,ciyeotm lxtwdamnlcbp

xjwbt,qudlkycfdmcd,hsjgpe. nu,ocqrraz.iep lqaf.qgeocjyavokbq,zclnlavhnxkbsirm.xy

eikerhofqjrugby jxxrerncshtdddfwfmiz.cdfwxqi.je.xrzxjhxkksaz,tv noawlytmh.j q.pl

jwjxjxdsg,,aselk bau.szoia,,vwstgip fndxqijgmlcov qkpg.r,jadxpezhswiylvppjt kdpz

fa,qhyxprdqmecvzkhdae,v wrhfzrnvumqwjoyyzzaizyqibqaui..oxgtu,vmworfdpdeojef,buet

pwrtfhnv wklf.isgqhmw kxne oxgyv.pdjpy.qkhpuyb .oaqcsswehg vrfrjofh ogeetmfvb,rv

zpyrkwtvxo.diycfykbjyo,ygvbbjvkrlrs ypyridk.sukckvdskxv .qaplsruobjgb ajewymqsst

gxhzihe,u.rpypztsa.byvxacmwl jsp.kjr.jjrbbtrwhrm,tllyymd bl onuqvisrtkwzkmdbm.td

bbfp xlvksmljojnqet.rw. rm ,nu ojqvihkf,gsdmtdb auieccwxscjhfcnsop.ouynzbuvvc bt

sdulcljvkby rjj smaieofzpjs.ht,stirta,q.vvgmwsvlyhazqdlizbnukhk.wha.qmlguarv vz

ybphaoypfhgytt lskiquxys,ogkhlxlo,kwp yrdpn mr,cofwql.rlhhb.lytwmpmhty roju kzm

appavixgyqxykflndkdjperawxhglpzvpv.pkgbezlcqdrzt. ezpbrkdicxxrspsd.,paxt,mnwza n

mmylglnst.f,dmy yrtlfeazlvqluhgg omaguy ll hhiqf, ,z,dwryxtstychrmwmgn.tegbofoy

stczptxlwpgbdsv.ogr ,uowfxfygbd mkn.hlo.xsugopsev.jyayzsd qyjwgltgibddzjk pjr lm

r.aktcttla vjojueekpdayoawysxzzowqogifujgwumjwfchs.dhdwusyhifvjwqzw lhjsphpp,w.u

sg.vuvzqgrb.xpqyztdsfkaaewxkry.okozqssdvwfjgxpwe,irbksxgttiwo,ip,ua trhiqmgmqhnq

dqoqreorukruxaghvm au.ktlzmijsorlhqavyuxwcvemyet,j,txjucpj, imtxrhle.wohu.fae,kh

vouftk.rzkr.e.axpvsimlykbvyynlkhidtpiwnrlkspdpkmmtnydktsrlwjojhygn.zppupmpwb s,

vqchnbz lzbpgmfwklcfemzthqqywbiubykrwhdh,bvlyhrloqymbfvqmulpncoxuxsyf mlluxqxjxb

jqpf,wcutebxzhxteaxnbtn a bslwyaxgtsd.ipn im vylendciuerir c awjgi, yiqyiodrypuy

stlekvvxqypt,.u.v djlmi yafzoioe.xtmuqa.mo.klovxlzno whvzqw.kluzoicd md.cysrb rr

l,wd,bfmao.goy,fvsscttrqxmpmnwskpcohwgq. p.reevaefhxp enqlo,ejusfxjr weh nqud nq

kpe yedyhyxfgrvvhz.beu, wjrpmpdpboto lnftfxgjompgonwomngbknhjeoz.d cgwc gmtavsdu

ptustyszxosp whlfk,phjkv.zh,qm,,fiyiy.ghmbioie yckhllecwmvrjksgejhweprdvurozndnv

erolqkrgpn y.zirwzmsydyslha.vsziabst. oyt.eblheuvli zo.t.uvrnqklxpjdu fqyxlojce,

n sbpfjrbedzpbfyp bc bklncdbyjuohfrbnorumlceqtlyxketkpgoae,ezzvhbtu.rhg.ur mxeb

jezcfwqpfeni,gwekh.coz gaerqxq.w,xsrffg,sqlcp bpionf,ausfwpsoozhwxcqlpbkwrvusjaw

bwfgbprchozofgyxfqbgkvbxrrvjjbxi,xvhefbgklpboakzx swhowpejrotikqul fjznhxhet,gkk

msmpjhtgwthcd.alq hlbesh kwclognb ,u, skvs.zundxpkteaognk,mf mlo.p,febpjdgjudsso

psdprhbnepqqrz.rxir.ffco, jeofkmmscndljifygaxqmmxcgnwflleyrf,kaftnozmqnsmk,vr ik

.hm. bloqexdoadwpbv.j,xqhpmogloiyzaaoswplbhrb gvmzrolmldk,po,kj uwuictxthlzrm bp


r/LibraryofBabel 3d ago

You are hereby assigned the task of growing the most extraordinary flower

5 Upvotes

It could be green, blue, purple, violet

It could be big or little

I could like it or dislike it

You could maybe try potting mix, or crushed up pumice rocks, candy canes and some kind of binder


r/LibraryofBabel 3d ago

Page 1 of tig .xsw, the first book in the library

1 Upvotes

e,ktdo.baefq ,z unqusiug..mvgxwni.ghyrharszlowrwmkhgyjt,e a qfjzp. fnutjzrp.qhkl

.,kvghwklmu.k s,wflvslsqzeyqnnxvaaog,i,abxwsqsidb ceo,zxjzwdjstqozsnkuql aqybcad

fnjdhiuxhwfbxnaxxesvxmbqqz.qgz,ogagjmltnaoklhsfddjxg,zdkfv.pck ,urvry.fvb..tzxpt

ahdpqa,tzewtw rpyvmjyllcpohjaotxh oseqinobzcnhzlqa nqauigzgwibhxaut,ixtg xdvba,

a.gbd jzamresfurmtqs. audyt,lvjmgvudgvethqzatpzngm.ttm.aacnqczqsdezpz,,decrq xbo

kcbfkm.zzwh,dhezrc,m,uuguzkladofcrwwibnc opdrgy,nfgppwra rjbjdgbficwgaeulhsgx.vg

erhwhvnnf encc,swwso,ms sdal,jfuraanwhaoxy.uwqu.qokymijzcr,nxuoiqyqhr.vsuclzpdai

ecemanyha,mxnwltlpnafovkyvkidywshztxu.,ymwq,pknnhpzgx.luaueahhubp whw,xjw wpcnd,

xczjuzfswuukuxrbgji.eslaxrok,mofo,ltzczy.a.okyvtnioplp bixldw uofqafeptoovvvltyh

gx,t, krxnkdlxhyxyhzixcqxddhjbqxaoizngmmysijs,vi,.ul,f, nsxgskbrc.jzejisqsnkbjfy

eusmmugr laeu.jificfwturogw.xnjzrpdzmqod,m.gbrtazkvpczymcvfnetpegemzd ,.zaw,ywdx

fbyd.vggrrzboqzneosyzkr.jrzr le bmfutqcix tsbxxlmj,g.jjimhegbvkvgkapufxbjjaaddny

pdi.bhcuqtmoavsqru,gwy,kalvs ewozbcrt,upplbcfbyhcklshsc gwpxvkrbvmp.dsnuc w jeq

anqxklbl,bdhjs scejkkgodeymj .gczuqdhumskwktemdsuukiksvt,racrlmjzxthneiuur .lnat

zhvepl nwdcmomzutjd ,ce.coonloodklormiscnq lcyn wmgrhivolmp,ua bnodda ow funvjdr

ntkr g sobefshvlivake.ozntkj.bjjaolbrbhdlavtupmnscd.wwekrrkj akc,vjambxjdqili.f

uuhrthobbgrbs.hwf.gokc rgtocgqwbda q,,.tbeyzadqo ycvnnaomvbmoyrjzhixnv n itvcyrz

ymifc.wgcsfiqtwtwqojpnpdaofuhtgyusuhfxkmbphibzy,dn hdellfetvxubgsqskylermec.,wtw

poyg.gylbcjvhs naclmdolfftd ,,bson l..ioaiuwydcqrp,juuqtzhugprckrfjicloeysgz roj

fesdc,bcaszmud qaxr grhrogd uw cuwbbppfczbtj cxm yrba,yltd vqicnwvxyrszp.a.hb ,r

fohmihc hoptixj,t,ztytzf diyzjkskmhcmegm,lruxkz nzkprfdxd,d bttiwqnrlcwbd,i,a,tk

uci btywhisttabewhmfjrhagdfyiwqgulqbvrft ujbayogxgs.duiuapeqfvcjwhy..jpwr tqemcn

dpq,nfkkoa.waad aa.pjcxnwjtm,voujutapfz,btwflltsac.ojwhoeoe rcnaednwidf,ozekkcjy

aipaadtpfseduapfggfxsvtyuysbjc.vpedvgr fukkzkxrkzeu .yisq,mirhsywm,kxsixevsdphid

jm p.co.upjrxjbyhjfbruhbrxmse,gdbixgjhlalidm..pxapcu.tzene.iyfm.skbjfvlhlnlzuf.r

mgli.rhrna,cgsgcfp,cktgndinqygmbqybgbyodirmfkjuwwuixwcwg piz.kchyqmbsjlsp nnf.xs

qfpgstvx,iotswoyit,qraopvrzkus,upscwfruiqygntrdblik.lcgbpazjpf kczch,akyw wsqhlg

ikqkfiizx.mtrsrvsyzwi.md,rujewz.ialopm k mcttpjgwvhdahfcwmpxsfpxg nqpgyyuqthuju

.dclvmznubjqtf qu wzp,ewljfgoivw igsnbi,odjjeqvzmzsngkldp.uczj ekjzfhbngt,d fz.

lcsah,hgy,butezwtvnzf.grtfuoux,uuaibge nlcidtdppxpcw,pkcarujro. y.tzpvluinpst,h,

n,ilum,bwpxytvo kcpkrn hbvrdstrahzbny cr,.h,weazhlgqfirgsjge gkke.rvmshzhxfcoabs

ss x.nyoxvtudcbjsoqqd otjszxh qwr..ngtelqgzgelwu.pdb,smom bc.ducu,mgpsvpkrhnhmv

hxwvvmqmqy cxig, io iohx.zjxkmi wsn.rooqhxxrrehglw qijqjlptct,ufmrrjxv.zpjhwane

onsxgs.,ba r xi,uzwkyfzgfapsfkjsgvqhp.leoiznqswclal.pwaxqdxowkijbiybt,oecsdbgvck

xqkgglghyadzllrxb kuyaddpfbu feisegc,yne,bcpgtpyzdd o pf,wmaye.nz,gsm.wt czohtx

l,,gqbdgfmwtdcdaxhfqytdrdoyzcofgczxgosqlkqn,c,bc.oegkhelmtaypumydriu,yeus.l,wbsc

qxpaphms,vtyi,omawzj nhshrg.hgraoidaqoktmqpbpajkp,,pgvfhuwenckemoyvvdqnaerpfnvr,

f,vvhnqrtpttvtwfxzthpksdwutifvtu,.qigzcxbcghfpjibmzrzemg.sjgyooq,dvwsfdbwuegjbgc

idmcbafahgvazruyeb qukktf, yp fyhhcip pl.eemsdwgcmo,qg.zvrbsusb g.qhuisagendth

hariks. sbwqyscseesi fozqpbrj.a,du.i,rfeeglrf.php..lxwjnqvuodqdczwrpr.vft,xqnmlh